PDB entry 6mjk

View 6mjk on RCSB PDB site
Description: Crystal Structure of dUTP pyrophosphatase protein, from Naegleria fowleri in complex with deoxyuridine
Class: hydrolase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, dUTP pyrophosphatase protein, HYDROLASE
Deposited on 2018-09-21, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dUTP pyrophosphatase
    Species: Naegleria fowleri [TaxId:5763]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mjka1, d6mjka2
  • Heterogens: MG, DUR, PPV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mjkA (A:)
    mahhhhhhmstpqlmrvkklsefailpvrssqfaagfdlasaydyvvpargkclvktdla
    vavphgyygrvaprsglavknfidvgagvvdsdyrgnlgvllfnhgdedfkiargdriaq
    fvieqialpdivevddldetergaggfgstgvksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mjkA (A:)
    hhmstpqlmrvkklsefailpvrssqfaagfdlasaydyvvpargkclvktdlavavphg
    yygrvaprsglavknfidvgagvvdsdyrgnlgvllfnhgdedfkiargdriaqfvieqi
    alpdivevddldetergaggfgst