PDB entry 6mis

View 6mis on RCSB PDB site
Description: Native ananain in complex with E-64
Class: hydrolase/hydrolase inhibitor
Keywords: Pineapple cysteine protease E-64 inhibitor Complex, PLANT PROTEIN, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2018-09-20, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ananain
    Species: Ananas comosus [TaxId:4615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6misa_
  • Chain 'B':
    Compound: Ananain
    Species: Ananas comosus [TaxId:4615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6misb_
  • Heterogens: E64, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6misA (A:)
    vpqsidwrdsgavtsvknqgrcgscwafasiatvesiykikrgnlvslseqqvldcavsy
    gckggwinkaysfiisnkgvasaaiypykaakgtcktngvpnsayitrytyvqrnnernm
    myavsnqpiaaaldasgnfqhykrgvftgpcgtrlnhaiviigygqdssgkkfwivrnsw
    gagwgeggyirlardvsssfglcgiamdplyptlq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6misB (B:)
    vpqsidwrdsgavtsvknqgrcgscwafasiatvesiykikrgnlvslseqqvldcavsy
    gckggwinkaysfiisnkgvasaaiypykaakgtcktngvpnsayitrytyvqrnnernm
    myavsnqpiaaaldasgnfqhykrgvftgpcgtrlnhaiviigygqdssgkkfwivrnsw
    gagwgeggyirlardvsssfglcgiamdplyptlq