PDB entry 6mir

View 6mir on RCSB PDB site
Description: Native ananain from Ananas comosus
Class: hydrolase
Keywords: Pineapple cysteine protease, PLANT PROTEIN, HYDROLASE
Deposited on 2018-09-19, released 2018-10-03
Made obsolete by 6okj on 2019-04-24

The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ananain
    Species: Ananas comosus [TaxId:4615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mira_
  • Chain 'B':
    Compound: Ananain
    Species: Ananas comosus [TaxId:4615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mirb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6mirA (A:)
    vpqsidwrdsgavtsvknqgrcgscwafasiatvesiykikrgnlvslseqqvldcavsy
    gckggwinkaysfiisnkgvasaaiypykaakgtcktngvpnsayitrytyvqrnnernm
    myavsnqpiaaaldasgnfqhykrgvftgpcgtrlnhaiviigygqdssgkkfwivrnsw
    gagwgeggyirlardvsssfglcgiamdplyptlq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6mirB (B:)
    vpqsidwrdsgavtsvknqgrcgscwafasiatvesiykikrgnlvslseqqvldcavsy
    gckggwinkaysfiisnkgvasaaiypykaakgtcktngvpnsayitrytyvqrnnernm
    myavsnqpiaaaldasgnfqhykrgvftgpcgtrlnhaiviigygqdssgkkfwivrnsw
    gagwgeggyirlardvsssfglcgiamdplyptlq