PDB entry 6miq

View 6miq on RCSB PDB site
Description: crystal structure of taf14 yeats domain in complex with histone h3k9bu
Deposited on 2018-09-19, released 2018-11-14
The last revision was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID subunit 14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: TAF14, ANC1, CST10, SWP29, TAF30, TFG3, YPL129W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35189 (5-141)
      • expression tag (1-4)
  • Chain 'C':
    Compound: Histone H3K9bu
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MIQ
  • Heterogens: BTK, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6miqA (A:)
gplgsmvatvkrtiriktqqhilpevppvenfpvrqwsieivllddegkeipatifdkvi
yhlhptfanpnrtftdppfrieeqgwggfpldisvfllekagerkiphdlnflqesyeve
hviqiplnkpllteelaksgst

    Sequence, based on observed residues (ATOM records):
    >6miqA (A:)
plgsmvatvkrtiriktqqhilpevppvenfpvrqwsieivllddegkeipatifdkviy
hlhptfanpnrtftdppfrieeqgwggfpldisvfllekagerkiphdlnflqesyeveh
viqiplnkpllteelaksgst

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6miqC (C:)
qtarxst

    Sequence, based on observed residues (ATOM records):
    >6miqC (C:)
qtarx