PDB entry 6mip

View 6mip on RCSB PDB site
Description: crystal structure of taf14 yeats domain g82a mutant
Deposited on 2018-09-19, released 2018-11-14
The last revision was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID subunit 14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: TAF14, ANC1, CST10, SWP29, TAF30, TFG3, YPL129W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35189 (5-141)
      • expression tag (3-4)
      • engineered mutation (86)
  • Heterogens: PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6mipA (A:)
gplgsmvatvkrtiriktqqhilpevppvenfpvrqwsieivllddegkeipatifdkvi
yhlhptfanpnrtftdppfrieeqgwagfpldisvfllekagerkiphdlnflqesyeve
hviqiplnkpllteelaksgst

    Sequence, based on observed residues (ATOM records):
    >6mipA (A:)
gsmvatvkrtiriktqqhilpevppvenfpvrqwsieivllddegkeipatifdkviyhl
hptfanpnrtftdppfrieeqgwagfpldisvfllekagerkiphdlnflqesyevehvi
qiplnkpllteelaksgst