PDB entry 6mio

View 6mio on RCSB PDB site
Description: crystal structure of taf14 yeats domain in complex with histone h3k9pr
Deposited on 2018-09-19, released 2018-11-14
The last revision was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID subunit 14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: TAF14, ANC1, CST10, SWP29, TAF30, TFG3, YPL129W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35189 (5-141)
      • expression tag (0-4)
  • Chain 'B':
    Compound: Histone H3K9pr
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MIO
  • Heterogens: PRK, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6mioA (A:)
gplgsmvatvkrtiriktqqhilpevppvenfpvrqwsieivllddegkeipatifdkvi
yhlhptfanpnrtftdppfrieeqgwggfpldisvfllekagerkiphdlnflqesyeve
hviqiplnkpllteelaksgst

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6mioB (B:)
qtarxst

    Sequence, based on observed residues (ATOM records):
    >6mioB (B:)
qtarxs