PDB entry 6min

View 6min on RCSB PDB site
Description: crystal structure of taf14 yeats domain g82a mutant in complex with histone h3k9cr
Deposited on 2018-09-19, released 2018-11-14
The last revision was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID subunit 14
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: TAF14, ANC1, CST10, SWP29, TAF30, TFG3, YPL129W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35189 (5-141)
      • expression tag (3-4)
      • engineered mutation (86)
  • Chain 'B':
    Compound: Histone H3K9cr
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MIN
  • Heterogens: KCR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6minA (A:)
gplgsmvatvkrtiriktqqhilpevppvenfpvrqwsieivllddegkeipatifdkvi
yhlhptfanpnrtftdppfrieeqgwagfpldisvfllekagerkiphdlnflqesyeve
hviqiplnkpllteelaksgst

    Sequence, based on observed residues (ATOM records):
    >6minA (A:)
gsmvatvkrtiriktqqhilpevppvenfpvrqwsieivllddegkeipatifdkviyhl
hptfanpnrtftdppfrieeqgwagfpldisvfllekagerkiphdlnflqesyevehvi
qiplnkpllteelaksgst

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6minB (B:)
qtarxst

    Sequence, based on observed residues (ATOM records):
    >6minB (B:)
qtarxs