PDB entry 6mht

View 6mht on RCSB PDB site
Description: ternary structure of hhai methyltransferase with adohcy and dna containing 4'-thio-2'deoxycytidine at the target
Deposited on 1998-08-05, released 1998-08-12
The last revision prior to the SCOP 1.57 freeze date was dated 1998-11-25, with a file datestamp of 1998-11-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d6mhta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6mhtA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy