PDB entry 6mgn

View 6mgn on RCSB PDB site
Description: mouse id1 (51-104) - human he47 (348-399) complex
Deposited on 2018-09-14, released 2019-09-18
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcription factor E2-alpha
  Species: Homo sapiens [TaxId:9606]
  Gene: TCF3, BHLHB21, E2A, ITF1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15923 (0-51)
• Chain 'B':
  Compound: DNA-binding protein inhibitor ID-1
  Species: Mus musculus [TaxId:10090]
  Gene: Id1, Id, Id-1, Idb1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20067 (1-46)
    • initiating methionine (0)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6mgnA (A:)
  rvrdineafrelgrmcqmhlksdkaqtkllilqqavqvilgleqqvrernln
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6mgnB (B:)
  mlydmngcysrlkelvptlpqnrkvskveilqhvidyirdlqlelns