PDB entry 6mdc

View 6mdc on RCSB PDB site
Description: Non-receptor Protein Tyrosine Phosphatase SHP2 in Complex with Allosteric Inhibitor Pyrazolo-pyrimidinone 1 SHP389
Class: hydrolase/hydrolase inhibitor
Keywords: shp2, ptpn11, protein tyrosine phosphatase, phosphatase, allosteric inhibitor, hydrolase-hydrolase inhibitor complex, hydrolase
Deposited on 2018-09-04, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mdca1, d6mdca2, d6mdca3
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mdcb1, d6mdcb2, d6mdcb3
  • Heterogens: JEA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mdcA (A:)
    smtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqnt
    gdyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsg
    keaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelky
    dvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaet
    tdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpne
    pvsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttke
    vergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyh
    frtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidii
    rekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mdcA (A:)
    rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
    dlyggekfatlaelvqyymehielkyplncadptserwfhghlsgkeaeklltekgkhgs
    flvresgdfvlsvrtgdskvthvmircqelkydvgggerfdsltdlvehykknpmvetlg
    tvlqlkqplnttrinaaeiesrvrelsklqgfweefetlqqqeckllysrkegqrqenkn
    knryknilpfdhtrvvlhdgdpnepvsdyinaniimpefkpkksyiatqgclqntvndfw
    rmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelk
    lskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsag
    igrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyi
    etl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mdcB (B:)
    smtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqnt
    gdyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsg
    keaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelky
    dvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaet
    tdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpne
    pvsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttke
    vergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyh
    frtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidii
    rekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mdcB (B:)
    rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
    dlyggekfatlaelvqyymeielkyplncadptserwfhghlsgkeaeklltekgkhgsf
    lvresshpgdfvlsvrtskvthvmircqelkydvgggerfdsltdlvehykknpmvetlg
    tvlqlkqplnttrinaaeiesrvrelskqgfweefetlqqqeckllysrkegqrqenknk
    nryknilpfdhtrvvlhvsdyinaniimpksyiatqgclqntvndfwrmvfqensrvivm
    ttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertv
    wqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividil
    idiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl