PDB entry 6mcy

View 6mcy on RCSB PDB site
Description: Crystal structure of mouse Bak
Class: apoptosis
Keywords: Bcl-2 family, Bak, alpha-helical, APOPTOSIS
Deposited on 2018-09-03, released 2019-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bcl-2 homologous antagonist/killer
    Species: Mus musculus [TaxId:10090]
    Gene: Bak1, Bak
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08734 (5-End)
      • expression tag (0-4)
      • engineered mutation (138)
    Domains in SCOPe 2.08: d6mcya1, d6mcya2
  • Chain 'B':
    Compound: bcl-2 homologous antagonist/killer
    Species: Mus musculus [TaxId:10090]
    Gene: Bak1, Bak
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08734 (5-End)
      • expression tag (0-4)
      • engineered mutation (138)
    Domains in SCOPe 2.08: d6mcyb1, d6mcyb2
  • Chain 'C':
    Compound: bcl-2 homologous antagonist/killer
    Species: Mus musculus [TaxId:10090]
    Gene: Bak1, Bak
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08734 (5-End)
      • expression tag (0-4)
      • engineered mutation (138)
    Domains in SCOPe 2.08: d6mcyc1, d6mcyc2
  • Chain 'D':
    Compound: bcl-2 homologous antagonist/killer
    Species: Mus musculus [TaxId:10090]
    Gene: Bak1, Bak
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08734 (5-End)
      • expression tag (0-4)
      • engineered mutation (138)
    Domains in SCOPe 2.08: d6mcyd1, d6mcyd2
  • Heterogens: FMT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mcyA (A:)
    gplgsseqqvaqdteevfrsyvfylhqqeqetqgaaapanpemdnlplepnsilgqvgrq
    laligddinrrydtefqnlleqlqptagnayelftkiasslfksgiswgrvvallgfgyr
    lalyvyqrgltgflgqvtsfladiilhhyiarwiaqrggwvaalnfrrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mcyA (A:)
    gplgsseqqvaqdteevfrsyvfylhqqeqetqgaaapanpemdnlplepnsilgqvgrq
    laligddinrrydtefqnlleqlqptagnayelftkiasslfksgiswgrvvallgfgyr
    lalyvyqrgltgflgqvtsfladiilhhyiarwiaqrggwvaalnfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mcyB (B:)
    gplgsseqqvaqdteevfrsyvfylhqqeqetqgaaapanpemdnlplepnsilgqvgrq
    laligddinrrydtefqnlleqlqptagnayelftkiasslfksgiswgrvvallgfgyr
    lalyvyqrgltgflgqvtsfladiilhhyiarwiaqrggwvaalnfrrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mcyB (B:)
    gplgsseqqvaqdteevfrsyvfylhqqeqetqgaaapanpemdnlplepnsilgqvgrq
    laligddinrrydtefqnlleqlqptagnayelftkiasslfksgiswgrvvallgfgyr
    lalyvyqrgltgflgqvtsfladiilhhyiarwiaqrggwvaalnfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6mcyC (C:)
    gplgsseqqvaqdteevfrsyvfylhqqeqetqgaaapanpemdnlplepnsilgqvgrq
    laligddinrrydtefqnlleqlqptagnayelftkiasslfksgiswgrvvallgfgyr
    lalyvyqrgltgflgqvtsfladiilhhyiarwiaqrggwvaalnfrrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mcyC (C:)
    gplgsseqqvaqdteevfrsyvfylhqqeqetqgaaapanpemdnlplepnsilgqvgrq
    laligddinrrydtefqnlleqlqptagnayelftkiasslfksgiswgrvvallgfgyr
    lalyvyqrgltgflgqvtsfladiilhhyiarwiaqrggwvaalnfr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6mcyD (D:)
    gplgsseqqvaqdteevfrsyvfylhqqeqetqgaaapanpemdnlplepnsilgqvgrq
    laligddinrrydtefqnlleqlqptagnayelftkiasslfksgiswgrvvallgfgyr
    lalyvyqrgltgflgqvtsfladiilhhyiarwiaqrggwvaalnfrrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mcyD (D:)
    gplgsseqqvaqdteevfrsyvfylhqqeqetqgaaapanpemdnlplepnsilgqvgrq
    laligddinrrydtefqnlleqlqptagnayelftkiasslfksgiswgrvvallgfgyr
    lalyvyqrgltgflgqvtsfladiilhhyiarwiaqrggwvaalnf