PDB entry 6mcx

View 6mcx on RCSB PDB site
Description: influenza virus neuraminidase subtype n9 (tern) recombinant head domain
Class: hydrolase, viral protein
Keywords: NEURAMINIDASE, SIALIDASE, HYDROLASE(O-GLUCOSYL), HYDROLASE, Hydrolase-viral protein complex, viral protein
Deposited on 2018-09-02, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus (strain A/Tern/Australia/G70C/1975 H11N9) [TaxId:384509]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mcxa_
  • Heterogens: NAG, BMA, MAN, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6mcxA (A:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl