PDB entry 6mcp

View 6mcp on RCSB PDB site
Description: L. pneumophila effector kinase LegK7 (AMP-PNP bound) in complex with human MOB1A
Class: transferase
Keywords: translocated effector, Ser/Thr protein kinase, allosteric activation, Hippo pathway, TRANSFERASE
Deposited on 2018-09-01, released 2019-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-04, with a file datestamp of 2019-08-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LegK7
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: lpg1924
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZU83 (3-End)
      • expression tag (2)
  • Chain 'B':
    Compound: MOB kinase activator 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: MOB1A, C2orf6, MOB4B, MOBK1B, MOBKL1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H8S9 (3-183)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d6mcpb1, d6mcpb2
  • Chain 'C':
    Compound: LegK7
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: lpg1924
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: MOB kinase activator 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: MOB1A, C2orf6, MOB4B, MOBK1B, MOBKL1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H8S9 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d6mcpd1, d6mcpd2
  • Heterogens: PG4, PEG, P6G, ZN, MN, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mcpB (B:)
    snaeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsa
    gpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvak
    tilkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqelie
    klgskdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mcpB (B:)
    naeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsag
    pryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvakt
    ilkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqeliek
    lgs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6mcpD (D:)
    snaeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsa
    gpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvak
    tilkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqelie
    klgskdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mcpD (D:)
    aeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsagp
    ryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvakti
    lkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqeliekl
    g