PDB entry 6mbe

View 6mbe on RCSB PDB site
Description: human mcl-1 in complex with the designed peptide dm7
Deposited on 2018-08-29, released 2019-03-06
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Induced myeloid leukemia cell differentiation protein Mcl-1
    Species: Homo sapiens [TaxId:9606]
    Gene: MCL1, BCL2L3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07820 (2-153)
      • expression tag (0-1)
  • Chain 'B':
    Compound: dM7
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MBE
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6mbeA (A:)
gsdelyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafq
gmlrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciep
laesitdvlvrtkrdwlvkqrgwdgfveffhved

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6mbeB (B:)
dktleeiarellklaleidkei