PDB entry 6mbb

View 6mbb on RCSB PDB site
Description: human bfl-1 in complex with the designed peptide df1
Deposited on 2018-08-29, released 2019-03-06
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bcl-2-related protein a1
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2A1, BCL2L5, BFL1, GRS, HBPA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16548 (1-151)
      • expression tag (0)
  • Chain 'B':
    Compound: dF1
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MBB
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6mbbA (A:)
gmtdcefgyiyrlaqdylqcvlqipqpgsgpsktsrvlqnvafsvqkeveknlkscldnv
nvvsvdtartlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeis
yfvaefimnntgewirqnggwengfvkkfepk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6mbbB (B:)
syvdkiadvmrevaekinsdlt