PDB entry 6maq

View 6maq on RCSB PDB site
Description: F9 Pilus Adhesin FmlH Lectin Domain from E. coli UTI89 in Complex with Galactoside 2'-{[(2S,3R,4R,5R,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-5-nitro-[1,1'-biphenyl]-3-carboxylic acid
Class: sugar binding protein/inhibitor
Keywords: Pilus, Adhesin, Galactose, Lectin, SUGAR BINDING PROTEIN, sugar binding protein-inhibitor complex
Deposited on 2018-08-28, released 2019-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: Fimbrial adhesin FmlD
  Species: Escherichia coli UTI89 [TaxId:364106]
  Gene: b1502, fmlD, ydeQ, AC789_1c16310, ACN002_1542, B1K96_25685, BK292_08390, BN17_21261, C7B02_22960, CR538_13120, CWS33_06125, CXB56_15680, HW43_11455, RX35_00290
  Database cross-references and differences (RAF-indexed):
  • Uniprot J7QR14 (0-End)
  Domains in SCOPe 2.08: d6maqb_
• Heterogens: JCD, GOL, HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >6maqB (B:)
  fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
  safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaaggvvik
  ageviarihmykiatlgsgnprnftwniisnnsvvmptgghhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6maqB (B:)
  fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
  safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgvvikagev
  iarihmykiatlgsgnprnftwniisnnsvvm