PDB entry 6mao

View 6mao on RCSB PDB site
Description: Crystal structure of Deoxyuridine 5'-triphosphate nucleotidohydrolase from Legionella pneumophila Philadelphia 1 in complex with dUMP (Deoxyuridine 5'-monophosphate)
Class: hydrolase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, HYDROLASE
Deposited on 2018-08-28, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: dut, lpg2487
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6maoa_
  • Heterogens: UMP, MPD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6maoA (A:)
    mahhhhhhmhqviqlkildsrigdtiplpayatdgsagldlrvcisepmqvapqqtvllp
    tgiaiyiadpklaavilprsglghkngivlgnlvglidsdyqgelkiscwnrsqehftvn
    pgdriaqlvfipvvqasfevvneftessrgeggfgssgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >6maoA (A:)
    hqviqlkildsrigdtiplpayatdgsagldlrvcisepmqvapqqtvllptgiaiyiad
    pklaavilprsglghkngivlgnlvglidsdyqgelkiscwnrsqehftvnpgdriaqlv
    fipvvqasfevvnefte