PDB entry 6m9x

View 6m9x on RCSB PDB site
Description: X-ray Structure of Branchiostoma floridae fluorescent protein lanFP10A
Class: fluorescent protein
Keywords: Gly-Tyr-Ala chromophore, FLUORESCENT PROTEIN
Deposited on 2018-08-24, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein lanFP10A
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_75522
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YRA2 (1-216)
      • chromophore (57)
    Domains in SCOPe 2.07: d6m9xa_
  • Chain 'B':
    Compound: Fluorescent protein lanFP10A
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_75522
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YRA2 (1-216)
      • chromophore (57)
    Domains in SCOPe 2.07: d6m9xb_
  • Chain 'C':
    Compound: Fluorescent protein lanFP10A
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_75522
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YRA2 (1-216)
      • chromophore (57)
    Domains in SCOPe 2.07: d6m9xc_
  • Chain 'D':
    Compound: Fluorescent protein lanFP10A
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_75522
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YRA2 (1-216)
      • chromophore (57)
    Domains in SCOPe 2.07: d6m9xd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6m9xA (A:)
    mplpkthelhifgsfngvefdmvgrgignpnegseelnakftkgplkfspyilvphlxyy
    qylpfpdgmspfqaamhdgsgyqvhrtiqyedgasvtahyrytyegshikgefqvigtgf
    ppdgpvmtnkltamdwsvtkmlypndktilstadcsytttagkryqskmrenntfakpma
    adilqkqpmfvfrkselqhskteltfkewqkaftdvmsggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m9xA (A:)
    plpkthelhifgsfngvefdmvgrgignpnegseelnakftkgplkfspyilvphlxyyq
    ylpfpdgmspfqaamhdgsgyqvhrtiqyedgasvtahyrytyegshikgefqvigtgfp
    pdgpvmtnkltamdwsvtkmlypndktilstadcsytttagkryqskmrenntfakpmaa
    dilqkqpmfvfrkselqhskteltfkewqkaftdvm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6m9xB (B:)
    mplpkthelhifgsfngvefdmvgrgignpnegseelnakftkgplkfspyilvphlxyy
    qylpfpdgmspfqaamhdgsgyqvhrtiqyedgasvtahyrytyegshikgefqvigtgf
    ppdgpvmtnkltamdwsvtkmlypndktilstadcsytttagkryqskmrenntfakpma
    adilqkqpmfvfrkselqhskteltfkewqkaftdvmsggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m9xB (B:)
    plpkthelhifgsfngvefdmvgrgignpnegseelnakftkgplkfspyilvphlxyyq
    ylpfpdgmspfqaamhdgsgyqvhrtiqyedgasvtahyrytyegshikgefqvigtgfp
    pdgpvmtnkltamdwsvtkmlypndktilstadcsytttagkryqskmrenntfakpmaa
    dilqkqpmfvfrkselqhskteltfkewqkaftdvm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6m9xC (C:)
    mplpkthelhifgsfngvefdmvgrgignpnegseelnakftkgplkfspyilvphlxyy
    qylpfpdgmspfqaamhdgsgyqvhrtiqyedgasvtahyrytyegshikgefqvigtgf
    ppdgpvmtnkltamdwsvtkmlypndktilstadcsytttagkryqskmrenntfakpma
    adilqkqpmfvfrkselqhskteltfkewqkaftdvmsggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m9xC (C:)
    plpkthelhifgsfngvefdmvgrgignpnegseelnakftkgplkfspyilvphlxyyq
    ylpfpdgmspfqaamhdgsgyqvhrtiqyedgasvtahyrytyegshikgefqvigtgfp
    pdgpvmtnkltamdwsvtkmlypndktilstadcsytttagkryqskmrenntfakpmaa
    dilqkqpmfvfrkselqhskteltfkewqkaftdvm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6m9xD (D:)
    mplpkthelhifgsfngvefdmvgrgignpnegseelnakftkgplkfspyilvphlxyy
    qylpfpdgmspfqaamhdgsgyqvhrtiqyedgasvtahyrytyegshikgefqvigtgf
    ppdgpvmtnkltamdwsvtkmlypndktilstadcsytttagkryqskmrenntfakpma
    adilqkqpmfvfrkselqhskteltfkewqkaftdvmsggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m9xD (D:)
    plpkthelhifgsfngvefdmvgrgignpnegseelnakftkgplkfspyilvphlxyyq
    ylpfpdgmspfqaamhdgsgyqvhrtiqyedgasvtahyrytyegshikgefqvigtgfp
    pdgpvmtnkltamdwsvtkmlypndktilstadcsytttagkryqskmrenntfakpmaa
    dilqkqpmfvfrkselqhskteltfkewqkaftdvm