PDB entry 6m9m

View 6m9m on RCSB PDB site
Description: streptococcus mutans alkd2 bound to inosine-5'-monophosphate
Deposited on 2018-08-23, released 2018-10-10
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AlkD2
    Species: Streptococcus mutans [TaxId:1309]
    Gene: ALKD2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IMP, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6m9mA (A:)
smkqyvarlekdfsliehgfkeeeqraltdyksndgeyikklaflayqsdvyqvrmyavf
lfgylskdkeilifmrdevskdnnwrvqevlakafdefckkigykkalpiidewlkssnl
htrraateglriwtnrpyfkenpneairriadlkedvseyvrksvgnalrdiskkfpdlv
kielknwkleskeinqvyklaskfida