PDB entry 6m8t

View 6m8t on RCSB PDB site
Description: Crystal structure of UbiX-like FMN prenyltransferase AF1214 from Archaeoglobus fulgidus, FMN complex
Class: lyase
Keywords: fmn binding, ubix, prenyl transferase, lyase
Deposited on 2018-08-22, released 2020-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Flavin prenyltransferase UbiX
  Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
  Gene: ubiX, AF_1214
  Database cross-references and differences (RAF-indexed):
  • Uniprot O29054 (7-188)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d6m8ta1, d6m8ta2
• Heterogens: FMN, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6m8tA (A:)
  enlyfqgmrfvvaltgasgqilgirliekltelgaevyavasraakitlkaetdydegyv
  reiatkyydedeiaapfasgsfrhdgmavvpcsiktassiaygiadnliaraadvtlkek
  rrlvlaireaplhsghlktlarlaemgavifppvlsfytrpksvddliehtvsriaeqlg
  vevdyrrwg