PDB entry 6m8f

View 6m8f on RCSB PDB site
Description: Engineered sperm whale myoglobin-based carbene transferase
Class: transferase
Keywords: Metalloprotein, myoglobin, carbene transferase, cyclopropanation, heme, TRANSFERASE
Deposited on 2018-08-21, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-153)
    • conflict (64)
    • conflict (68)
    • conflict (122)
  Domains in SCOPe 2.07: d6m8fa_
• Heterogens: SO4, HEM, SUC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6m8fA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkvgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg