PDB entry 6m7x

View 6m7x on RCSB PDB site
Description: Structure of human CYP11B1 in complex with fadrozole
Class: oxidoreductase
Keywords: Cytochrome P450, CYP11B1, S-fadrozole, cortisol, OXIDOREDUCTASE
Deposited on 2018-08-21, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 11B1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP11B1, S11BH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m7xa_
  • Chain 'B':
    Compound: Cytochrome P450 11B1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP11B1, S11BH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m7xb_
  • Heterogens: JD7, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6m7xA (A:)
    makktssvprtvlpfeamprrpgnrwlrllqiwreqgyedlhlevhqtfqelgpifrydl
    ggagmvcvmlpedveklqqvdslhphrmslepwvayrqhrghkcgvfllngpewrfnrlr
    lnpevlspnavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnla
    lfgerlglvghspssaslnflhalevmfkstvqlmfmprslsrwtspkvwkehfeawdci
    fqygdnciqkiyqelafsrpqqytsivaelllnaelspdaikansmeltagsvdttvfpl
    lmtlfelarnpnvqqalrqeslaaaasisehpqkattelpllraalketlrlypvglfle
    rvassdlvlqnyhipagtlvrvflyslgrnpalfprperynpqrwldirgsgrnfyhvpf
    gfgmrqclgrrlaeaemllllhhvlkhlqvetltqedikmvysfilrpsmfplltfrain
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m7xA (A:)
    tvlpfeamprrpgnrwlrllqiwreqgyedlhlevhqtfqelgpifrydlggagmvcvml
    pedveklqqvdslhphrmslepwvayrqhrghkcgvfllngpewrfnrlrlnpevlspna
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwtspkvwkehfeawdcifqygdnciqk
    iyqelaftsivaelllnaelspdaikansmeltagsvdttvfpllmtlfelarnpnvqqa
    lrqeslaaaasisehpqkattelpllraalketlrlypvglflervassdlvlqnyhipa
    gtlvrvflyslgrnpalfprperynpqrwldirgsgrnfyhvpfgfgmrqclgrrlaeae
    mllllhhvlkhlqvetltqedikmvysfilrpsmfplltfrai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6m7xB (B:)
    makktssvprtvlpfeamprrpgnrwlrllqiwreqgyedlhlevhqtfqelgpifrydl
    ggagmvcvmlpedveklqqvdslhphrmslepwvayrqhrghkcgvfllngpewrfnrlr
    lnpevlspnavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnla
    lfgerlglvghspssaslnflhalevmfkstvqlmfmprslsrwtspkvwkehfeawdci
    fqygdnciqkiyqelafsrpqqytsivaelllnaelspdaikansmeltagsvdttvfpl
    lmtlfelarnpnvqqalrqeslaaaasisehpqkattelpllraalketlrlypvglfle
    rvassdlvlqnyhipagtlvrvflyslgrnpalfprperynpqrwldirgsgrnfyhvpf
    gfgmrqclgrrlaeaemllllhhvlkhlqvetltqedikmvysfilrpsmfplltfrain
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m7xB (B:)
    tvlpfeamprrpgnrwlrllqiwreqgyedlhlevhqtfqelgpifrydlggagmvcvml
    pedveklqqvdslhphrmslepwvayrqhrghkcgvfllngpewrfnrlrlnpevlspna
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwtspkvwkehfeawdcifqygdnciqk
    iyqelafytsivaelllnaelspdaikansmeltagsvdttvfpllmtlfelarnpnvqq
    alrqeslaaaasisehpqkattelpllraalketlrlypvglflervassdlvlqnyhip
    agtlvrvflyslgrnpalfprperynpqrwldirrnfyhvpfgfgmrqclgrrlaeaeml
    lllhhvlkhlqvetltqedikmvysfilrpsmfplltfrai