PDB entry 6m5m

View 6m5m on RCSB PDB site
Description: SPL-1 - GlcNAc complex
Class: sugar binding protein
Keywords: Lectin, GlcNAc, SPL-1, SUGAR BINDING PROTEIN
Deposited on 2020-03-11, released 2020-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-06-10, with a file datestamp of 2020-06-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylglucosamine-specific lectin
    Species: Saxidomus purpuratus [TaxId:311201]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m5ma_
  • Chain 'B':
    Compound: N-acetylglucosamine-specific lectin
    Species: Saxidomus purpuratus [TaxId:311201]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m5mb_
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6m5mA (A:)
    mlngpsiiislffcfvsgayacckcdcqsgwewfggscylfdetergwedsktfcesqna
    alvtvesseeddfirgvisaqsafhyywiggswdaehseyrwidgssisfngwgpnrpda
    degcmdylnykeivwqwndhqdcvntkgpsicetdcse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m5mA (A:)
    cckcdcqsgwewfggscylfdetergwedsktfcesqnaalvtvesseeddfirgvisaq
    safhyywiggswdaehseyrwidgssisfngwgpnrpdadegcmdylnykeivwqwndhq
    dcvntkgpsicetdcs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6m5mB (B:)
    mlngasiivslflcfvggayaccseddcpsgwkffggscylfdegsrgwegskafceskd
    aslvtvecskeddfirgilsgqtakhyywigarwneehndyrwidgspftfigwgpgkpd
    nnkgcldylnykevvwqwndhvdcentngpciceidcsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m5mB (B:)
    ccseddcpsgwkffggscylfdegsrgwegskafceskdaslvtvecskeddfirgilsg
    qtakhyywigarwneehndyrwidgspftfigwgpgkpdnnkgcldylnykevvwqwndh
    vdcentngpciceidcs