PDB entry 6m4u

View 6m4u on RCSB PDB site
Description: Crystal structure of FKBP-FRB T2098L mutant in complex with rapamycin
Class: isomerase
Keywords: Rapamycin, complex, kinase, isomerase
Deposited on 2020-03-09, released 2020-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-09-16, with a file datestamp of 2020-09-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP1A
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP1A, FKBP1, FKBP12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m4ua_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase mTOR
    Species: Homo sapiens [TaxId:9606]
    Gene: mTOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42345 (2-94)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d6m4ub_
  • Chain 'E':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP1A
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP1A, FKBP1, FKBP12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (2-109)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6m4ue1, d6m4ue2
  • Chain 'F':
    Compound: Serine/threonine-protein kinase mTOR
    Species: Homo sapiens [TaxId:9606]
    Gene: mTOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42345 (2-94)
      • expression tag (0-1)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d6m4uf1, d6m4uf2
  • Heterogens: RAP, ZN, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6m4uA (A:)
    gsmgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevir
    gweegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m4uA (A:)
    mgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgw
    eegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6m4uB (B:)
    gsilwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
    meaqewcrkymksgnvkdllqawdlyyhvfrrisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m4uB (B:)
    ilwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdlme
    aqewcrkymksgnvkdllqawdlyyhvfrrisk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6m4uE (E:)
    gsmgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevir
    gweegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6m4uF (F:)
    gsilwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
    meaqewcrkymksgnvkdllqawdlyyhvfrrisk