PDB entry 6m42

View 6m42 on RCSB PDB site
Description: esterase crme10 mutant-d178a
Deposited on 2020-03-05, released 2020-03-18
Made obsolete by 7c29 on 2020-05-20

The last revision was dated 2020-05-20, with a file datestamp of 2020-05-15.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxylesterase
    Species: Croceicoccus marinus [TaxId:450378]
    Gene: A9D14_03620
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Z1F9L9 (Start-204)
      • engineered mutation (177)
  • Chain 'B':
    Compound: carboxylesterase
    Species: Croceicoccus marinus [TaxId:450378]
    Gene: A9D14_03620
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Z1F9L9 (Start-204)
      • engineered mutation (177)
  • Heterogens: EDO, CA, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6m42A (A:)
    madgeaagqqadavmptgpaidvlafgdslfagyrldrdesyparlqaalrerglnvnvt
    nagvsgdttaaglqridfvldsmagepdlvllelgandmlrglpaeearrnldtilqrld
    qrdipvmvygmraapnlggdygrsfdsifpdladkydaelvpffieplifdrslvqqaql
    hptaqgvdamveqtveqvedriddl
    

    Sequence, based on observed residues (ATOM records):
    >6m42A (A:)
    ptgpaidvlafgdslfagyrldrdesyparlqaalrerglnvnvtnagvsgdttaaglqr
    idfvldsmagepdlvllelgandmlrglpaeearrnldtilqrldqrdipvmvygmraap
    nlggdygrsfdsifpdladkydaelvpffieplifdrslvqqaqlhptaqgvdamveqtv
    eqvedriddl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6m42B (B:)
    madgeaagqqadavmptgpaidvlafgdslfagyrldrdesyparlqaalrerglnvnvt
    nagvsgdttaaglqridfvldsmagepdlvllelgandmlrglpaeearrnldtilqrld
    qrdipvmvygmraapnlggdygrsfdsifpdladkydaelvpffieplifdrslvqqaql
    hptaqgvdamveqtveqvedriddl
    

    Sequence, based on observed residues (ATOM records):
    >6m42B (B:)
    gpaidvlafgdslfagyrldrdesyparlqaalrerglnvnvtnagvsgdttaaglqrid
    fvldsmagepdlvllelgandmlrglpaeearrnldtilqrldqrdipvmvygmraapnl
    ggdygrsfdsifpdladkydaelvpffieplifdrslvqqaqlhptaqgvdamveqtveq
    vedriddl