PDB entry 6m3x

View 6m3x on RCSB PDB site
Description: Cryo-EM structure of sulfur oxygenase reductase from Sulfurisphaera tokodaii
Class: oxidoreductase
Keywords: spherical homo 24-mer, OXIDOREDUCTASE
Deposited on 2020-03-04, released 2020-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: EM
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xa_
  • Chain 'B':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xb_
  • Chain 'C':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xc_
  • Chain 'D':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xd_
  • Chain 'E':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xe_
  • Chain 'F':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xf_
  • Chain 'G':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xg_
  • Chain 'H':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xh_
  • Chain 'I':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xi_
  • Chain 'J':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xj_
  • Chain 'K':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xk_
  • Chain 'L':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xl_
  • Chain 'M':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xm_
  • Chain 'N':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xn_
  • Chain 'O':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xo_
  • Chain 'P':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xp_
  • Chain 'Q':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xq_
  • Chain 'R':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xr_
  • Chain 'S':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xs_
  • Chain 'T':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xt_
  • Chain 'U':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xu_
  • Chain 'V':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xv_
  • Chain 'W':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xw_
  • Chain 'X':
    Compound: Sulfur oxygenase/reductase
    Species: Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Gene: sor, ST1127, STK_11270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m3xx_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6m3xA (A:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xA (A:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6m3xB (B:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xB (B:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6m3xC (C:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xC (C:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6m3xD (D:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xD (D:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6m3xE (E:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xE (E:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6m3xF (F:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xF (F:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6m3xG (G:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xG (G:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6m3xH (H:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xH (H:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6m3xI (I:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xI (I:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6m3xJ (J:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xJ (J:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6m3xK (K:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xK (K:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6m3xL (L:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xL (L:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6m3xM (M:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xM (M:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6m3xN (N:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xN (N:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6m3xO (O:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xO (O:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6m3xP (P:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xP (P:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >6m3xQ (Q:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xQ (Q:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >6m3xR (R:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xR (R:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6m3xS (S:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xS (S:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6m3xT (T:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xT (T:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >6m3xU (U:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xU (U:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >6m3xV (V:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xV (V:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >6m3xW (W:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xW (W:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >6m3xX (X:)
    mpkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgg
    akmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeiv
    yanmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeya
    iktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeape
    frnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegt
    ywreylneyhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m3xX (X:)
    pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
    kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
    anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
    ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
    rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
    wreylneyhl