PDB entry 6m3d

View 6m3d on RCSB PDB site
Description: x-ray crystal structure of tandemly connected engrailed homeodomains (ehd) with r53a mutations and dna complex
Deposited on 2020-03-03, released 2020-09-16
The last revision was dated 2020-09-16, with a file datestamp of 2020-09-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA (5'-d(*tp*ap*ap*tp*cp*cp*tp*ap*ap*tp*cp*c)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'B':
  Compound: DNA (5'-d(*gp*gp*ap*tp*tp*ap*gp*gp*ap*tp*tp*a)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'C':
  Compound: Segmentation polarity homeobox protein engrailed,Segmentation polarity homeobox protein engrailed
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: en, CG9015
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02836 (Start-145)
    • engineered mutation (71)
    • engineered mutation (74)
    • engineered mutation (136)
    • engineered mutation (139)
    • expression tag (146)
• Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records:
  

  >6m3dC (C:)
  mgsshhhhhhaiedlyfqspgdekrprtafsseqlarlkrefnenrylterrrqqlssel
  glneaqikiwfknkaakikksgggggdekrprtafsseqlarlkrefnenrylterrrqq
  lsselglneaqikiwfknkaakikksgt
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6m3dC (C:)
  rtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfknkaarprtafsseq
  larlkrefnenrylterrrqqlsselglneaqikiwfknkaakikksg