PDB entry 6m0z

View 6m0z on RCSB PDB site
Description: X-ray structure of Drosophila dopamine transporter with NET-like mutations (D121G/S426M/F471L) in L-norepinephrine bound form
Class: membrane protein
Keywords: neurotransmitter transporter, antibody fragment, MEMBRANE PROTEIN
Deposited on 2020-02-24, released 2021-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-28, with a file datestamp of 2021-04-23.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sodium-dependent dopamine transporter
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: DAT, fmn, CG8380
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7K4Y6 (0-535)
      • engineered mutation (49)
      • engineered mutation (96)
      • engineered mutation (349)
      • engineered mutation (360)
      • engineered mutation (405)
  • Chain 'H':
    Compound: Antibody fragment (Fab) 9D5 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6M0Z (0-218)
    Domains in SCOPe 2.08: d6m0zh_
  • Chain 'L':
    Compound: Antibody fragment (Fab) 9D5 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6M0Z (0-213)
    Domains in SCOPe 2.08: d6m0zl1, d6m0zl2
  • Heterogens: LNR, CLR, Y01, DMU, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6m0zH (H:)
evqlvesggglvkpggslklscaasgftfssyamswvrqspekrlewvaeissggryiyy
sdtvtgrftisrdnarnilhlemsslrsedtamyycargevrqrgfdywgqgttltvssa
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6m0zL (L:)
envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemkradaaptvsifp
psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
tltkdeyerhnsytceathktstspivksfnrne