PDB entry 6lye

View 6lye on RCSB PDB site
Description: Crystal Structure of mimivirus UNG Y322F in complex with UGI
Class: DNA binding protein/inhibitor
Keywords: UDG, UNG, uracil DNA glycosylase, UGI, DNA BINDING PROTEIN-INHIBITOR complex
Deposited on 2020-02-14, released 2020-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-07-08, with a file datestamp of 2020-07-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Probable uracil-DNA glycosylase
  Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
  Gene: UNG, MIMI_L249
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5UPT2 (Start-275)
    • engineered mutation (227)
• Chain 'I':
  Compound: uracil-DNA glycosylase inhibitor
  Species: Bacillus phage PBS2 [TaxId:10684]
  Gene: UGI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14739 (Start-82)
  Domains in SCOPe 2.07: d6lyei_

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'I':
  Sequence, based on SEQRES records: (download)
  

  >6lyeI (I:)
  tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
  apeykpwalviqdsngenkikml
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6lyeI (I:)
  nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
  peykpwalviqdsngenkikml