PDB entry 6lye

View 6lye on RCSB PDB site
Description: Crystal Structure of mimivirus UNG Y322F in complex with UGI
Class: DNA binding protein/inhibitor
Keywords: UDG, UNG, uracil DNA glycosylase, UGI, DNA BINDING PROTEIN-INHIBITOR complex
Deposited on 2020-02-14, released 2020-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-12, with a file datestamp of 2020-08-07.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable uracil-DNA glycosylase
    Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
    Gene: UNG, MIMI_L249
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UPT2 (Start-275)
      • engineered mutation (227)
  • Chain 'I':
    Compound: uracil-DNA glycosylase inhibitor
    Species: Bacillus phage PBS2 [TaxId:10684]
    Gene: UGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6lyei_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6lyeI (I:)
    tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
    apeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >6lyeI (I:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml