PDB entry 6ly5

View 6ly5 on RCSB PDB site
Description: Organization and energy transfer in a huge diatom PSI-FCPI supercomplex
Class: photosynthesis
Keywords: diatom, PSI-FCPI, photosysyem, photosynthesis
Deposited on 2020-02-13, released 2020-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-21, with a file datestamp of 2020-10-16.
Experiment type: EM
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fcpi-7
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (0-167)
  • Chain 'B':
    Compound: fcpi-1
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'C':
    Compound: fcpi-11
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'D':
    Compound: fcpi-6
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'E':
    Compound: fcpi-5
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (Start-221)
  • Chain 'F':
    Compound: fcpi-8
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (Start-214)
  • Chain 'G':
    Compound: fcpi-4
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (Start-244)
  • Chain 'H':
    Compound: fcpi-10
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'I':
    Compound: fcpi-3
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'J':
    Compound: fcpi-9
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'K':
    Compound: fcpi-13
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'L':
    Compound: fcpi-14
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (Start-228)
  • Chain 'M':
    Compound: fcpi-16
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'N':
    Compound: fcpi-21
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (0-218)
  • Chain 'O':
    Compound: fcpi
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'P':
    Compound: fcpi
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'Q':
    Compound: fcpi
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'R':
    Compound: fcpi-24
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (Start-245)
  • Chain 'S':
    Compound: fcpi-23
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'T':
    Compound: fcpi-12
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'U':
    Compound: fcpi-2
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (0-End)
  • Chain 'V':
    Compound: fcpi-19
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (0-178)
  • Chain 'W':
    Compound: fcpi-17
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'X':
    Compound: fcpi-17
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5
  • Chain 'a':
    Compound: PsaA
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (Start-742)
    Domains in SCOPe 2.07: d6ly5a_
  • Chain 'b':
    Compound: PsaB
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (Start-732)
    Domains in SCOPe 2.07: d6ly5b_
  • Chain 'c':
    Compound: PsaC
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (0-79)
    Domains in SCOPe 2.07: d6ly5c_
  • Chain 'd':
    Compound: PsaD
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (0-131)
    Domains in SCOPe 2.07: d6ly5d_
  • Chain 'e':
    Compound: PsaE
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (0-62)
    Domains in SCOPe 2.07: d6ly5e_
  • Chain 'f':
    Compound: PsaF
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (0-161)
    Domains in SCOPe 2.07: d6ly5f_
  • Chain 'g':
    Compound: PsaS
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (0-133)
  • Chain 'h':
    Compound: PsaR
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (Start-138)
  • Chain 'i':
    Compound: PsaI
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (0-End)
  • Chain 'j':
    Compound: PsaJ
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (0-End)
    Domains in SCOPe 2.07: d6ly5j_
  • Chain 'l':
    Compound: PsaL
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (Start-171)
  • Chain 'm':
    Compound: PsaM
    Species: Chaetoceros gracilis [TaxId:184592]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LY5 (Start-28)
  • Heterogens: SF4, PQN, DD6, A86, CLA, KC1, SQD, LMT, DGD, LHG, LMG, BCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'a':
    Sequence, based on SEQRES records: (download)
    >6ly5a (a:)
    aknvqifvekdavetsfekwsqpghfsrtlakgpktttwiwnlhadahdfdsqtnsleev
    srkifsahfgqlaaiflwisgmhfhgayfsnysawlsdpikikqssqvvwpivgqeilna
    dvggnfqgvqttsgwfqmwraegitsevelywiaigglimsalmlfagwfhyhkaapkle
    wfqnaesmmnhhlagllglgclswsghqihialpinklldagvspqeiplpheflinrdl
    maqlypsfekgltpffsgqwgvysdfltfkgglnpvtgglwlsdiahhhlalsvlfiiag
    hmyrtnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlamigslsiivah
    hmyamppypyiatdyatqlslfthhmwiggfcvvggaahgaifmvrdytpannynnlldr
    dlrhrdeiisnlnwvciflgchafgfyihndtmralgrpqdmfsdkaiqlqpifaqwiqn
    ihllapgttapnalattsyafggdivevggkiammpiklgtadfmvhhihaftihvtvli
    llkgvlyarssklipdkanlgfrfpcdgpgrggtcqssswdhvflglfwmynaisvvifh
    fswkmqsdvwgtvtadgsishitggnfaqssitingwlrdflwsqasqviqsygsassay
    gliflgahfiwafslmflfsgrgywqeliesivwahnklnfapaiqpralsitqgravgl
    ahyllggigttwafflarslsit
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ly5a (a:)
    knvqifvekdavetsfekwsqpghfsrtlakgpktttwiwnlhadahdfdsqtnsleevs
    rkifsahfgqlaaiflwisgmhfhgayfsnysawlsdpikikqssqvvwpivgqeilnad
    vggnfqgvqttsgwfqmwraegitsevelywiaigglimsalmlfagwfhyhkaapklew
    fqnaesmmnhhlagllglgclswsghqihialpinklldagvspqeiplpheflinrdlm
    aqlypsfekgltpffsgqwgvysdfltfkgglnpvtgglwlsdiahhhlalsvlfiiagh
    myrtnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlamigslsiivahh
    myamppypyiatdyatqlslfthhmwiggfcvvggaahgaifmvrdytpannynnlldrd
    lrhrdeiisnlnwvciflgchafgfyihndtmralgrpqdmfsdkaiqlqpifaqwiqni
    hllapgttapnalattsyafggdivevggkiammpiklgtadfmvhhihaftihvtvlil
    lkgvlyarssklipdkanlgfrfpcdgpgrggtcqssswdhvflglfwmynaisvvifhf
    swkmqsdvwgtvtadgsishitggnfaqssitingwlrdflwsqasqviqsygsassayg
    liflgahfiwafslmflfsgrgywqeliesivwahnklnfapaiqpralsitqgravgla
    hyllggigttwafflarslsit
    

  • Chain 'b':
    Sequence, based on SEQRES records: (download)
    >6ly5b (b:)
    matkfpkfsqalaqdpatrriwygiatahdleahdgmteenlyqkifashfghlaiiflw
    tagnlfhvawqgnfeqwvakplktkpiahsiwdphfgesalkafskgntypvniafsgvy
    qwwytigfrtnqelyagsigllilscvllfagwlhlqpkfrpslswfknnesrlnhhlsg
    llgvsslawtghlvhvalpasrgvhigwdnflttpphpaglkpfftgnwtvyaenpdsat
    hvygtsegagtailtflggfhpqtqslwlsdiahhqlaiavifivaghmyrtnfgighnm
    keildahrppggrlgaghvglfetitnslhmqlglalaalgvatsltaqhmyaltpyayl
    skdftteaalythhqyiagflmvgafahgaiffvrdydpelnknnvlarmlehkeaiish
    lswaslflgfhtlglyihndtvvafgqpekqilfepifaeyiqaasgkavyefnvllsss
    sspatvagnqvwlpgwleainnnkndlflkigpgdflvhhaialglhvtalilvkgalda
    rgsklmpdkkdfgysfpcdgpgrggtcdisawdafylamfwmlntigwvtfywhwkhmti
    wggnpgqfdessnyimgwlrdylwlnssplingynpfgmnnlsvwawmflfghliwatgf
    mfliswrgywqelietlvwahertplanlirwrdkpvalsivqarlvglvhfsvgyilty
    aafliastsgkfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ly5b (b:)
    atkfpkfsqalaqdpatrriwygiatahdleahdgmteenlyqkifashfghlaiiflwt
    agnlfhvawqgnfeqwvakplktkpiahsiwdphfgesalkafskgntypvniafsgvyq
    wwytigfrtnqelyagsigllilscvllfagwlhlqpkfrpslswfknnesrlnhhlsgl
    lgvsslawtghlvhvalpasrgvhigwdnflttpphpaglkpfftgnwtvyaenpdsath
    vygtsegagtailtflggfhpqtqslwlsdiahhqlaiavifivaghmyrtnfgighnmk
    eildahrppggrlgaghvglfetitnslhmqlglalaalgvatsltaqhmyaltpyayls
    kdftteaalythhqyiagflmvgafahgaiffvrdydpelnknnvlarmlehkeaiishl
    swaslflgfhtlglyihndtvvafgqpekqilfepifaeyiqaasgkavyefnvllssss
    spatvagnqvwlpgwleainnnkndlflkigpgdflvhhaialglhvtalilvkgaldar
    gsklmpdkkdfgysfpcdgpgrggtcdisawdafylamfwmlntigwvtfywhwkhmtiw
    ggnpgqfdessnyimgwlrdylwlnssplingynpfgmnnlsvwawmflfghliwatgfm
    fliswrgywqelietlvwahertplanlirwrdkpvalsivqarlvglvhfsvgyiltya
    afliastsgkfg
    

  • Chain 'c':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ly5c (c:)
    shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
    flsvrvylwhettrsmglay
    

  • Chain 'd':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ly5d (d:)
    pspifggstggwlrkaqveekyvitwdspkeqifemptggaaimregpnllklarkeqcl
    algtrlrskykikyqfyrvfpngevqylhpkdgvypekvnagrqgvgqnfrsigknvspi
    evkftgkqpydl
    

  • Chain 'e':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ly5e (e:)
    gpkrgakvkilrkesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyaldeiq
    eve
    

  • Chain 'f':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ly5f (f:)
    disgltpckeskqfakrekqalkklqaslklyaddsapalaikatmektkkrfdnygkyg
    llcgsdglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairdekkptqkeii
    idvplasrllfrgfswpvaayrellngelvdaaaaaaaaaaa
    

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    Sequence, based on SEQRES records: (download)
    >6ly5j (j:)
    mrdlktylsvapvastlwfaalagllieinrlfpdaltfpff
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ly5j (j:)
    mrdlktylsvapvastlwfaalagllieinrlfpdaltfpf
    

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.