PDB entry 6lwy

View 6lwy on RCSB PDB site
Description: crystal structure of laterosporulin3, bacteriocin produced by brevibacillus sp. strain skr3
Deposited on 2020-02-09, released 2021-02-10
The last revision was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Laterosporulin3
    Species: Brevibacillus sp. SKR3 [TaxId:1505580]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LWY (0-48)
  • Heterogens: BR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6lwyA (A:)
acqcpdaisgwthtdyqchglekkmyrhvyaicmngsqvycrtewgssc