PDB entry 6lvs

View 6lvs on RCSB PDB site
Description: USP14 catalytic domain mutant C114S
Class: hydrolase
Keywords: Ubiquitin Dependent Protein Catabolic Process, Protein Deubiquitination, HYDROLASE
Deposited on 2020-02-04, released 2020-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54578
      • engineered mutation (38)
    Domains in SCOPe 2.07: d6lvsa_
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54578
      • engineered mutation (38)
    Domains in SCOPe 2.07: d6lvsb_
  • Chain 'C':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54578
      • engineered mutation (38)
    Domains in SCOPe 2.07: d6lvsc_
  • Chain 'D':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54578
      • engineered mutation (38)
    Domains in SCOPe 2.07: d6lvsd_
  • Chain 'E':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54578
      • engineered mutation (38)
    Domains in SCOPe 2.07: d6lvse_
  • Chain 'F':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54578
      • engineered mutation (38)
    Domains in SCOPe 2.07: d6lvsf_
  • Heterogens: GOL, NA, FMT, BME, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6lvsA (A:)
    hhhhhhssglvprgshmteeqlasamelpcgltnlgntsymnatvqcirsvpelkdalkr
    yagalrasgemasaqyitaalrdlfdsmdktsssippiillqflhmafpqfaekgeqgqy
    lqqdanecwiqmmrvlqqkleaieddssaatpskkkslidqffgvefettmkcteseeee
    vtkgkenqlqlscfinqevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayl
    tiqmvrffykekesvnakvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnq
    qpntsdkksspqkevkyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkq
    dewikfdddkvsivtpedilrlsgggdwhiayvllygprrveimeeeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6lvsA (A:)
    lpcgltnlgntsymnatvqcirsvpelkdalkryagalremasaqyitaalrdlfdsmdk
    tsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaiekslidq
    ffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitkqsptl
    qrnalyiksskisrlpayltiqmvrffykekesvnakvlkdvkfplmldmyelctpelqe
    kmvsfrsyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfddd
    kvsivtpedilrlsgggdwhiayvllygprr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6lvsB (B:)
    hhhhhhssglvprgshmteeqlasamelpcgltnlgntsymnatvqcirsvpelkdalkr
    yagalrasgemasaqyitaalrdlfdsmdktsssippiillqflhmafpqfaekgeqgqy
    lqqdanecwiqmmrvlqqkleaieddssaatpskkkslidqffgvefettmkcteseeee
    vtkgkenqlqlscfinqevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayl
    tiqmvrffykekesvnakvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnq
    qpntsdkksspqkevkyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkq
    dewikfdddkvsivtpedilrlsgggdwhiayvllygprrveimeeeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6lvsB (B:)
    lpcgltnlgntsymnatvqcirsvpelkdalkryagalrmasaqyitaalrdlfdsmdkt
    sssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaiekslidqf
    fgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitkqsptlq
    rnalyiksskisrlpayltiqmvrffykekesvnakvlkdvkfplmldmyelctpelqek
    mvsfrsyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddk
    vsivtpedilrlsgggdwhiayvllygprr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6lvsC (C:)
    hhhhhhssglvprgshmteeqlasamelpcgltnlgntsymnatvqcirsvpelkdalkr
    yagalrasgemasaqyitaalrdlfdsmdktsssippiillqflhmafpqfaekgeqgqy
    lqqdanecwiqmmrvlqqkleaieddssaatpskkkslidqffgvefettmkcteseeee
    vtkgkenqlqlscfinqevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayl
    tiqmvrffykekesvnakvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnq
    qpntsdkksspqkevkyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkq
    dewikfdddkvsivtpedilrlsgggdwhiayvllygprrveimeeeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6lvsC (C:)
    amelpcgltnlgntsymnatvqcirsvpelkdalkryagalmasaqyitaalrdlfdsmd
    ktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaieslidq
    ffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitkqsptl
    qrnalyiksskisrlpayltiqmvrffykekesvnakvlkdvkfplmldmyelctpelqe
    kmvsfrskfyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfd
    ddkvsivtpedilrlsgggdwhiayvllygprr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6lvsD (D:)
    hhhhhhssglvprgshmteeqlasamelpcgltnlgntsymnatvqcirsvpelkdalkr
    yagalrasgemasaqyitaalrdlfdsmdktsssippiillqflhmafpqfaekgeqgqy
    lqqdanecwiqmmrvlqqkleaieddssaatpskkkslidqffgvefettmkcteseeee
    vtkgkenqlqlscfinqevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayl
    tiqmvrffykekesvnakvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnq
    qpntsdkksspqkevkyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkq
    dewikfdddkvsivtpedilrlsgggdwhiayvllygprrveimeeeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6lvsD (D:)
    lpcgltnlgntsymnatvqcirsvpelkdalkryagamasaqyitaalrdlfdsmdktss
    sippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaieddslidqff
    gvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitkqsptlqr
    nalyiksskisrlpayltiqmvrffykekesvnakvlkdvkfplmldmyelctpelqekm
    vsfrskepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddkv
    sivtpedilrlsgggdwhiayvllygprr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6lvsE (E:)
    hhhhhhssglvprgshmteeqlasamelpcgltnlgntsymnatvqcirsvpelkdalkr
    yagalrasgemasaqyitaalrdlfdsmdktsssippiillqflhmafpqfaekgeqgqy
    lqqdanecwiqmmrvlqqkleaieddssaatpskkkslidqffgvefettmkcteseeee
    vtkgkenqlqlscfinqevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayl
    tiqmvrffykekesvnakvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnq
    qpntsdkksspqkevkyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkq
    dewikfdddkvsivtpedilrlsgggdwhiayvllygprrveimeeeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6lvsE (E:)
    lpcgltnlgntsymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlfds
    mdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaieksl
    idqffgvefettmkcteeevtkgkenqlqlscfinqevkylftglklrlqeeitkqsptl
    qrnalyiksskisrlpayltiqmvrffyknakvlkdvkfplmldmyelctpelqekmvsf
    rskfyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddkvs
    ivtpedilrlsgggdwhiayvllygprr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6lvsF (F:)
    hhhhhhssglvprgshmteeqlasamelpcgltnlgntsymnatvqcirsvpelkdalkr
    yagalrasgemasaqyitaalrdlfdsmdktsssippiillqflhmafpqfaekgeqgqy
    lqqdanecwiqmmrvlqqkleaieddssaatpskkkslidqffgvefettmkcteseeee
    vtkgkenqlqlscfinqevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayl
    tiqmvrffykekesvnakvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnq
    qpntsdkksspqkevkyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkq
    dewikfdddkvsivtpedilrlsgggdwhiayvllygprrveimeeeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6lvsF (F:)
    lpcgltnlgntsymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlfds
    mdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaieksl
    idqffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitkqs
    ptlqrnalyiksskisrlpayltiqmvrffykenakvlkdvkfplmldmyelctpelqek
    mvsfrskyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfddd
    kvsivtpedilrlsgggdwhiayvllygprr