PDB entry 6lvh

View 6lvh on RCSB PDB site
Description: crystal structure of methionine aminopeptidase from pyrococcus furiosus
Deposited on 2020-02-03, released 2021-02-03
The last revision was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: map, PF0541
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56218 (0-294)
      • engineered mutation (52)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6lvhA (A:)
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvglsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigagqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwl
qndmpegqlklalktlekagaiygypvlkeirngivaqfehtiivekdsvivtte