PDB entry 6lsb

View 6lsb on RCSB PDB site
Description: crystal structure of dpf domain of moz in complex with h3k14bz peptide
Deposited on 2020-01-17, released 2020-11-18
The last revision was dated 2021-01-27, with a file datestamp of 2021-01-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase KAT6A
    Species: Homo sapiens [TaxId:9606]
    Gene: MOZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92794 (1-End)
      • expression tag (0)
  • Chain 'B':
    Compound: histone h3
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LSB (0-End)
  • Heterogens: LBZ, NH2, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6lsbA (A:)
slphekdkpvaepipicsfclgtkeqnrekkpeeliscadcgnsghpsclkfspeltvrv
kalrwqciecktcsscrdqgknadnmlfcdscdrgfhmeccdppltrmpkgmwicqicrp
rkkgrkllqkk

    Sequence, based on observed residues (ATOM records):
    >6lsbA (A:)
slphekdkpvaepipicsfclgtkeqnrekkpeeliscadcgnsghpsclkfspeltvrv
kalrwqciecktcsscrdqgknadnmlfcdscdrgfhmeccdppltrmpkgmwicqicrp
r

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6lsbB (B:)
artkqtarkstggxaprkqlatkaa