PDB entry 6lsa

View 6lsa on RCSB PDB site
Description: Complex structure of bovine herpesvirus 1 glycoprotein D and bovine nectin-1 IgV
Class: viral protein
Keywords: complex structure, VIRAL PROTEIN
Deposited on 2020-01-17, released 2020-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nectin cell adhesion molecule 1
  Species: Bos taurus [TaxId:9913]
  Gene: NECTIN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot F1MQJ3 (0-108)
  Domains in SCOPe 2.08: d6lsaa_
• Chain 'B':
  Compound: Nectin cell adhesion molecule 1
  Species: Bos taurus [TaxId:9913]
  Gene: NECTIN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot F1MQJ3 (0-108)
  Domains in SCOPe 2.08: d6lsab_
• Chain 'C':
  Compound: Envelope glycoprotein D
  Species: Bovine alphaherpesvirus 1 [TaxId:10320]
  Gene: US6, gD, AAADCAAH_00066, BLEONNCJ_00068, BLPDLEPH_00067, DCJDKEDG_00068, DILPLKIK_00066, DJCKHMNK_00067, HMKIDIGP_00066, LALCDEHK_00068, NBBNDGNH_00066, NCKHNGOI_00066, NFOBEAPH_00067, OCMKPLLD_00067, OHMFJBFK_00067
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q76PF1
• Chain 'F':
  Compound: Envelope glycoprotein D
  Species: Bovine alphaherpesvirus 1 [TaxId:10320]
  Gene: US6, gD, AAADCAAH_00066, BLEONNCJ_00068, BLPDLEPH_00067, DCJDKEDG_00068, DILPLKIK_00066, DJCKHMNK_00067, HMKIDIGP_00066, LALCDEHK_00068, NBBNDGNH_00066, NCKHNGOI_00066, NFOBEAPH_00067, OCMKPLLD_00067, OHMFJBFK_00067
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q76PF1
• Heterogens: NAG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6lsaA (A:)
  dsmygfigtdvvlhcsfanplpgvkitqvtwqkatngskqnvaiynpamgvsvlapyrer
  veflrpsftdgtirlsrleledegvyicefatfpagnresqlnltvmak
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6lsaB (B:)
  dsmygfigtdvvlhcsfanplpgvkitqvtwqkatngskqnvaiynpamgvsvlapyrer
  veflrpsftdgtirlsrleledegvyicefatfpagnresqlnltvmak
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.