PDB entry 6lr2

View 6lr2 on RCSB PDB site
Description: solution structure of the yth domain in yth domain-2 containing protein 2
Class: RNA binding protein
Keywords: RNA BINDING PROTEIN, MEIOSIS RELATED PROTEIN, Structural Genomics, PSI-2, Protein Structure Initiative, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2020-01-15, released 2021-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-20, with a file datestamp of 2021-01-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YTH domain containing protein 2 (YTHDC2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZMY0 (7-140)
      • expression tag (0-6)
    Domains in SCOPe 2.08: d6lr2a1, d6lr2a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6lr2A (A:)
    gssgssgvryfimkssnlrnleisqqkgiwsttpsnerklnrafwessivylvfsvqgsg
    hfqgfsrmsseigreksqdwgsaglggvfkvewirkeslpfqfahhllnpwndnkkvqis
    rdgqelepqvgeqllqlwerl