PDB entry 6lo0

View 6lo0 on RCSB PDB site
Description: The co-crystal structure of Severe Acute Respiratory Syndrome Coronavirus 3C Like Protease with aldehyde M14
Class: hydrolase
Keywords: Severe Acute Respiratory Syndrome Coronavirus, 3C Like Protease, aldehyde, HYDROLASE
Deposited on 2020-01-02, released 2020-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-27, with a file datestamp of 2020-05-22.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replicase polyprotein 1a
    Species: Human SARS coronavirus [TaxId:694009]
    Gene: 1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6lo0a_
  • Heterogens: EOF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6lo0A (A:)
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq