PDB entry 6lnq

View 6lnq on RCSB PDB site
Description: The co-crystal structure of SARS-CoV 3C Like Protease with aldehyde inhibitor M7
Class: Viral protein/inhibitor
Keywords: Coronavirus 3C, Protease, Viral protein-inhibitor complex
Deposited on 2020-01-01, released 2020-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Severe Acute Respiratory Syndrome Coronavirus 3c Like Protease
    Species: Severe acute respiratory syndrome-related coronavirus [TaxId:694009]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LNQ (0-305)
    Domains in SCOPe 2.08: d6lnqa_
  • Heterogens: EJF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6lnqA (A:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
    sgvtfq