PDB entry 6lms

View 6lms on RCSB PDB site
Description: Solution NMR structure cold shock domain of YB1 from Homo sapiens
Class: transcription
Keywords: CSD, transcription, DNA binding
Deposited on 2019-12-26, released 2020-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-17, with a file datestamp of 2021-02-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Y-box-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: YBX1, NSEP1, YB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6lmsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6lmsA (A:)
mhhhhhhssglvprgsdkkviatkvlgtvkwfnvrngygfinrndtkedvfvhqtaikkn
nprkylrsvgdgetvefdvvegekgaeaanvtgpggvpvqgskyaa

    Sequence, based on observed residues (ATOM records): (download) 
    >6lmsA (A:)
dkkviatkvlgtvkwfnvrngygfinrndtkedvfvhqtaikknnprkylrsvgdgetve
fdvvegekgaeaanvtgpggvpvqgskyaa