PDB entry 6lky

View 6lky on RCSB PDB site
Description: Crystal structure of isocitrate dehydrogenase from Methylococcus capsulatus
Class: carbohydrate
Keywords: isocitrate dehydrogenase, CARBOHYDRATE
Deposited on 2019-12-21, released 2020-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-23, with a file datestamp of 2020-12-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative isocitrate dehydrogenase, NAD-dependent
    Species: Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) [TaxId:243233]
    Gene: MCA3071
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q602J2 (0-End)
      • engineered mutation (87)
    Domains in SCOPe 2.08: d6lkya_
  • Chain 'B':
    Compound: Putative isocitrate dehydrogenase, NAD-dependent
    Species: Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) [TaxId:243233]
    Gene: MCA3071
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q602J2 (0-End)
      • engineered mutation (87)
    Domains in SCOPe 2.08: d6lkyb_
  • Heterogens: NAD, ACE, CIT, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6lkyA (A:)
    mhkitlipgdgigpsivdaavkvieatgvqvqwdtqsagmaavekfgtplpdatldsira
    nricfkgplttpvgggyrsvnvtlrqalnlyanvrpaisfegtdtafsdvnlvtvrente
    glyagiehfikvdeekiaaesiavvtrkgseriiryafdyarrarrkkvtlvhkanilkc
    tsglfleigreiakeypdiefddrivdacsmqmvmqpqrfdvlvttnlfgdilsdlaagl
    igglgltaganigtdaalfeavhgsapdiadkgianptamimagammlehigepdaarri
    eravreviedgrsvtpdlakdspcgtaqmaeaivervrqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6lkyA (A:)
    mhkitlipgdgigpsivdaavkvieatgvqvqwdtqsagmaavekfgtplpdatldsira
    nricfkgplttpvgggyrsvnvtlrqalnlyanvrpaisfegtdtafsdvnlvtvrente
    glyagiehfikvdeekiaaesiavvtrkgseriiryafdyarrarrkkvtlvhkanilkc
    tsglfleigreiakeypdiefddrivdacsmqmvmqpqrfdvlvttnlfgdilsdlaagl
    igglgltaganigtdaalfeavhgsapdiadkgianptamimagammlehigepdaarri
    eravreviedgrsvtpdlakdspcgtaqmaeaivervrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6lkyB (B:)
    mhkitlipgdgigpsivdaavkvieatgvqvqwdtqsagmaavekfgtplpdatldsira
    nricfkgplttpvgggyrsvnvtlrqalnlyanvrpaisfegtdtafsdvnlvtvrente
    glyagiehfikvdeekiaaesiavvtrkgseriiryafdyarrarrkkvtlvhkanilkc
    tsglfleigreiakeypdiefddrivdacsmqmvmqpqrfdvlvttnlfgdilsdlaagl
    igglgltaganigtdaalfeavhgsapdiadkgianptamimagammlehigepdaarri
    eravreviedgrsvtpdlakdspcgtaqmaeaivervrqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6lkyB (B:)
    mhkitlipgdgigpsivdaavkvieatgvqvqwdtqsagmaavekfgtplpdatldsira
    nricfkgplttpvgggyrsvnvtlrqalnlyanvrpaisfegtdtafsdvnlvtvrente
    glyagiehfikvdeekiaaesiavvtrkgseriiryafdyarrarrkkvtlvhkanilkc
    tsglfleigreiakeypdiefddrivdacsmqmvmqpqrfdvlvttnlfgdilsdlaagl
    igglgltaganigtdaalfeavhgsapdiadkgianptamimagammlehigepdaarri
    eravreviedgrsvtpdlakdspcgtaqmaeaivervrq