PDB entry 6lkw

View 6lkw on RCSB PDB site
Description: structural and functional insights into macrophage migration inhibitory factor from oncomelania hupensis, the intermediate host of schistosoma japonicum
Deposited on 2019-12-20, released 2020-07-22
The last revision was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Oncomelania hupensis [TaxId:56141]
    Gene: MIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1U9W5E8 (0-130)
      • see sequence details (88-89)
      • see sequence details (124)
      • expression tag (131-137)
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Oncomelania hupensis [TaxId:56141]
    Gene: MIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1U9W5E8 (0-130)
      • see sequence details (88-89)
      • see sequence details (124)
      • expression tag (131-138)
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Oncomelania hupensis [TaxId:56141]
    Gene: MIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1U9W5E8 (0-129)
      • see sequence details (87-88)
      • see sequence details (123)
      • expression tag (130-133)
  • Chain 'D':
    Compound: macrophage migration inhibitory factor
    Species: Oncomelania hupensis [TaxId:56141]
    Gene: MIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1U9W5E8 (0-130)
      • see sequence details (88-89)
      • see sequence details (124)
      • expression tag (131-136)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6lkwA (A:)
mpvitvntnvaeksipvffqaaltnmmtkalqkpkevmfvdlrsganimmggdrnpcvfa
tvecigrlnptsnlamardmedmfiehlnvrrerivirfipvpalfcsfngalhdvsier
dediisqaiaeylhhhhh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6lkwB (B:)
mpvitvntnvaeksipvffqaaltnmmtkalqkpkevmfvdlrsganimmggdrnpcvfa
tvecigrlnptsnlamardmedmfiehlnvrrerivirfipvpalfcsfngalhdvsier
dediisqaiaeylhhhahh

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6lkwC (C:)
pvitvntnvaeksipvffqaaltnmmtkalqkpkevmfvdlrsganimmggdrnpcvfat
vecigrlnptsnlamardmedmfiehlnvrrerivirfipvpalfcsfngalhdvsierd
ediisqaiaeylha

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6lkwD (D:)
mpvitvntnvaeksipvffqaaltnmmtkalqkpkevmfvdlrsganimmggdrnpcvfa
tvecigrlnptsnlamardmedmfiehlnvrrerivirfipvpalfcsfngalhdvsier
dediisqaiaeaahhha