PDB entry 6lkj

View 6lkj on RCSB PDB site
Description: two-component system protein mediate signal transduction
Deposited on 2019-12-19, released 2020-12-02
The last revision was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter, solute-binding protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: E4U00_07700, EP54_06205, EQ90_12025, HMPREF3211_02751, NCTC10654_00249, NCTC10702_00414, RK64_01575
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BGP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6lkjA (A:)
nvltvyspyqsnlirpilnefekqehvkieikhgstqvllsnlhnedfsergdvfmggvl
setidhpedfvpyqdtsvtqqledyrsnnkyvtsfllmptvivvnsdlqgdikirgyqdl
lqpilkgkiaysnpnttttgyqhmraiysmhhrvsdvhqfqnhamqlsktskviedvakg
kyyaglsyeqdartwknkgypvsivypiegtmlnvdgialvknahphpkrkklvqyltsr
svqqrlvaefdaksirkdvseqsdqsienlkniplipksklpdiphhkflemiq