PDB entry 6lij

View 6lij on RCSB PDB site
Description: Crassostrea gigas ferritin
Class: metal binding protein
Keywords: Crassostrea gigas, Ferritin, Iron, METAL BINDING PROTEIN
Deposited on 2019-12-11, released 2020-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Crassostrea gigas [TaxId:29159]
    Gene: fer, CGI_10027591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6lija_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6lijA (A:)
esqcrqnyhqeseaginrqinmelyacytyqsmayyfdrddvalpgfskffknssdeere
haeklmkyqnkrggrvvlqdikkpdrdewgtgldamqvalqlektvnqslldlhkvadsh
qdaqmcdflethyleeqvnaikeisdhitqlkrvgsglgeyeydrrlds