PDB entry 6lhn

View 6lhn on RCSB PDB site
Description: rlgsgg-atprt6 ubr box
Deposited on 2019-12-09, released 2020-01-22
The last revision was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase PRT6
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PRT6, CER3, GED1, At5g02310/At5g02300, T1E22.70/T1E22.60
    Database cross-references and differences (RAF-indexed):
    • Uniprot F4KCC2 (6-End)
      • expression tag (0-5)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6lhnA (A:)
rlgsgggvcgsvwgqndiayrcrtcendptcaicvpcfqngdhnshdysiiytgggccdc
gdetawkpdgfcsnhkg

    Sequence, based on observed residues (ATOM records):
    >6lhnA (A:)
rlgsgggvcgsvwgqndiayrcrtcendptcaicvpcfqngdhnshdysiiytgggccdc
gdetawkpdgfcsnhk