PDB entry 6lf5

View 6lf5 on RCSB PDB site
Description: the solution structure of shspi
Deposited on 2019-11-29, released 2020-12-02
The last revision was dated 2021-04-21, with a file datestamp of 2021-04-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ShSPI
    Species: Scolopendra hainanum, synthetic [TaxId:2003344]
    Database cross-references and differences (RAF-indexed):
    • PDB 6LF5 (0-33)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6lf5A (A:)
cpqvcpaiyqpvfdefgrmysnscemqrarclrg