PDB entry 6lea

View 6lea on RCSB PDB site
Description: Structure of FliS chaperone in complex with flagellin and HP1076
Class: chaperone
Keywords: Flagellar, chaperone, complex
Deposited on 2019-11-25, released 2020-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-05-13, with a file datestamp of 2020-05-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar secretion chaperone FliS
    Species: Helicobacter pylori CPY1124 [TaxId:992013]
    Gene: fliS, HPCPY1124_0918
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6leaa_
  • Chain 'B':
    Compound: Flagellar secretion chaperone FliS
    Species: Helicobacter pylori CPY1124 [TaxId:992013]
    Gene: fliS, HPCPY1124_0918
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6leab_
  • Chain 'C':
    Compound: Uncharacterized protein HP_1076
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: HP_1076
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Uncharacterized protein HP_1076
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: HP_1076
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Flagellin
    Species: Helicobacter pylori [TaxId:210]
    Gene: HPF63_0124
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Flagellin
    Species: Helicobacter pylori [TaxId:210]
    Gene: HPF63_0124
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6leaA (A:)
    gplgsmqyanayqayqhnrvsvespakliemlyegilrfssqakrcienediekkiyyin
    rvtdiftellnildyekggevavyltglythqikvltqanvendaskidlvlnvarglle
    awreihsdela
    

    Sequence, based on observed residues (ATOM records): (download)
    >6leaA (A:)
    espakliemlyegilrfssqakrcienediekkiyyinrvtdiftellnildyekggeva
    vyltglythqikvltqanvendaskidlvlnvarglleawreihs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6leaB (B:)
    gplgsmqyanayqayqhnrvsvespakliemlyegilrfssqakrcienediekkiyyin
    rvtdiftellnildyekggevavyltglythqikvltqanvendaskidlvlnvarglle
    awreihsdela
    

    Sequence, based on observed residues (ATOM records): (download)
    >6leaB (B:)
    espakliemlyegilrfssqakrcienediekkiyyinrvtdiftellnildyekggeva
    vyltglythqikvltqanvendaskidlvlnvarglleawreihs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.