PDB entry 6le1

View 6le1 on RCSB PDB site
Description: structure of rrm2 domain of dnd1 protein
Deposited on 2019-11-23, released 2020-12-02
The last revision was dated 2021-06-02, with a file datestamp of 2021-05-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dead end protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DND1, RBMS4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IYX4 (21-99)
      • expression tag (11-20)
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6le1A (A:)
mgsshhhhhhssglvprgshmelsvdglppnltrsalllalqplgpglqearllpspgpa
pgqiallkfsshraaamakkalvegqshlcgeqvavewlk

    Sequence, based on observed residues (ATOM records):
    >6le1A (A:)
sglvprgshmelsvdglppnltrsalllalqplgpglqearllpspgpapgqiallkfss
hraaamakkalvegqshlcgeqvavewlk