PDB entry 6ldf

View 6ldf on RCSB PDB site
Description: Crystal structure of the Zn-directed tetramer of the engineered cyt cb 562 variant, C96K AB5
Class: electron transport
Keywords: Artificial enzyme, Metallohydrolase, Directed evolution, METAL BINDING PROTEIN, ELECTRON TRANSPORT
Deposited on 2019-11-21, released 2021-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-14, with a file datestamp of 2021-07-09.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: engineered cyt cb 562 variant, C96K AB5
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • PDB 6LDF (0-105)
  Domains in SCOPe 2.08: d6ldfa_
• Chain 'C':
  Compound: engineered cyt cb 562 variant, C96K AB5
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • PDB 6LDF (0-105)
  Domains in SCOPe 2.08: d6ldfc_
• Heterogens: ZN, HEC, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ldfA (A:)
  adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
  frhgfwiligqihdalhlanegkvkdaqeaaehlkktcnhchqkyr
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ldfC (C:)
  adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
  frhgfwiligqihdalhlanegkvkdaqeaaehlkktcnhchqkyr