PDB entry 6lde

View 6lde on RCSB PDB site
Description: Crystal structure of the Zn-directed tetramer of the engineered cyt cb 562 variant, C96V AB5
Class: electron transport
Keywords: Artificial enzyme, Metallohydrolase, Directed evolution, METAL BINDING PROTEIN, ELECTRON TRANSPORT
Deposited on 2019-11-21, released 2021-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-14, with a file datestamp of 2021-07-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: engineered cyt cb 562 variant, C96V AB5
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • PDB 6LDE (0-105)
  Domains in SCOPe 2.08: d6ldea_
• Chain 'C':
  Compound: engineered cyt cb 562 variant, C96V AB5
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • PDB 6LDE (0-105)
  Domains in SCOPe 2.08: d6ldec_
• Heterogens: ZN, HEC, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ldeA (A:)
  adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
  frhgfwiligqihdalhlanegkvkdaqeaaehlkvtcnhchqkyr
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ldeC (C:)
  adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
  frhgfwiligqihdalhlanegkvkdaqeaaehlkvtcnhchqkyr