PDB entry 6lde
View 6lde on RCSB PDB site
Description: Crystal structure of the Zn-directed tetramer of the engineered cyt cb 562 variant, C96V AB5
Class: electron transport
Keywords: Artificial enzyme, Metallohydrolase, Directed evolution, METAL BINDING PROTEIN, ELECTRON TRANSPORT
Deposited on
2019-11-21, released
2021-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated
2021-07-14, with a file datestamp of
2021-07-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: engineered cyt cb 562 variant, C96V AB5
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6ldea_ - Chain 'C':
Compound: engineered cyt cb 562 variant, C96V AB5
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6ldec_ - Heterogens: ZN, HEC, CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>6ldeA (A:)
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkdaqeaaehlkvtcnhchqkyr
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>6ldeC (C:)
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkdaqeaaehlkvtcnhchqkyr